95%

Cat. No.: RDP100016 Categories: ,

Rienden Biotechnology Co., Ltd. is a company which provide peptide products and peptide services. Our goal is that all the clients can benefit from our products and services with full satisfaction. If you need to custom peptide, please contact us for custom peptide synthesis service.

Cat.No. RDP100016
Sequence H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
Sequence(One Letter Code) [LL-37, 37 aa]
Purity ≥95%
Molecular Weight 4493.3
Molecular Formula
CAS Registry Number
Storage Conditions -20 ± 5 °C

Not for human use, research purposes only.